PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_31192
Common NameKK1_030443
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family MYB
Protein Properties Length: 249aa    MW: 28169.4 Da    PI: 10.1351
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_31192genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding35.32.6e-111445132
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmg 32
                     +g+WT+eEd++l+ +v+++G g+W++ +++ g
    C.cajan_31192 14 KGPWTPEEDKKLISYVEKHGHGNWRSFPAKAG 45
                     79**********************99888887 PP

2Myb_DNA-binding50.83.9e-1670113146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg ++ eEd+ +++++++lG++ W+ Ia++++ +Rt++++k++w++
    C.cajan_31192  70 RGDFSLEEDQTIIQLHALLGNK-WSIIAAHLP-KRTDNEIKNYWNT 113
                      899*******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.181956IPR017930Myb domain
SuperFamilySSF466892.95E-2811111IPR009057Homeodomain-like
SMARTSM007176.7E-51366IPR001005SANT/Myb domain
PfamPF002497.7E-101446IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.4E-181571IPR009057Homeodomain-like
PROSITE profilePS5129425.4665119IPR017930Myb domain
SMARTSM007171.1E-1569117IPR001005SANT/Myb domain
PfamPF002493.4E-1570113IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.3E-2672120IPR009057Homeodomain-like
CDDcd001672.13E-1173115No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 249 aa     Download sequence    Send to blast
MGRMTCCEKV GLKKGPWTPE EDKKLISYVE KHGHGNWRSF PAKAGNTTSP YLSFNLLLRW  60
INYLKPDIKR GDFSLEEDQT IIQLHALLGN KWSIIAAHLP KRTDNEIKNY WNTNIKKRLI  120
RMGLDPITHK PMKPNTFEGY GDSHDHSKDS INMGHVAQWE SARVEAEARG SMLQVGSGSS  180
LLPRLFLSKI PTHQPLSTQH GTMYNMYALV LAINHDIRSS VSTLVSLSFP PLLPTLDNSR  240
TRKAHAVMS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-23121195108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014621940.11e-122PREDICTED: myb-related protein 308-like
SwissprotQ9FLR11e-56MYB29_ARATH; Transcription factor MYB29
TrEMBLA0A151RZ770.0A0A151RZ77_CAJCA; Transcription factor MYB32
STRINGGLYMA02G12242.11e-121(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13536826
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G15310.16e-77myb domain protein 16